PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.FD7VR
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 322aa    MW: 36367.1 Da    PI: 6.5087
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.FD7VRgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.82.8e-291769153
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                 kprl+WtpeLH+rF+ea++qLGGsekAtPk+++++m+++gLtl+h+kSHLQ +
  Araip.FD7VR 17 KPRLKWTPELHQRFIEAINQLGGSEKATPKSLMRVMGIPGLTLYHLKSHLQAF 69
                 79*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-261569IPR009057Homeodomain-like
SuperFamilySSF466895.38E-141670IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-201769IPR006447Myb domain, plants
PfamPF002493.1E-71967IPR001005SANT/Myb domain
PfamPF143793.5E-22143190IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MENVQSSMHL VLSTDAKPRL KWTPELHQRF IEAINQLGGS EKATPKSLMR VMGIPGLTLY  60
HLKSHLQAFP FLLLAFTHSK YHGLLFFYQH IFSKYRLGKS QPQLEICSGN NKHEDCREMK  120
NSEGPCSSRE ESIGTQNEMT ESMQIAEALQ MQMEVQKKLY EQIEVQRHLQ LKIEAQGKYL  180
QSVLHKAQET LAGMINNGSP GSPPISELTE TRGGISWSCG QRKQNRGTMC SLEIESSLTS  240
SESSMDQRPN STNTTNTASL ELLPLFKESK EQEDESIIGR KRSSSCCVDQ PSKMSRSELV  300
SDIIDLNSEQ IDLNCSSSFW EQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1373639e-59BT137363.1 Medicago truncatula clone JCVI-FLMt-17O6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016190924.10.0PREDICTED: myb family transcription factor APL-like isoform X1
TrEMBLV7CMT01e-104V7CMT0_PHAVU; Uncharacterized protein
STRINGGLYMA20G04630.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.15e-66G2-like family protein